Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000296843
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family VOZ
Protein Properties Length: 543aa    MW: 61395.9 Da    PI: 6.2902
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000296843genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pp saflgpkcalwdc+rpaq    +qdycss ha la neglpg tpvlrp+gi lkdg+lf al+ k+qgk+vgip+c+gaat +spwn +elf
                    788*****************97..6*********************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                    dlslleget+rewlff +prrafesgnrkqrslpdysgrgwhesrkqvmke+gg+krsyymdpqpss +ewhl+eye+n++da+alyrlelk   +
                    ************************************************************************************************ PP

            VOZ 193 kksakgkvskdsladlqkklgrlta 217
                    kks+kgk s+d+ladlqkk+grlta
                    ***********************97 PP

           FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk........t 48 
                     Yn+Y ++vGFs+rk++++k+k+++e+t+r + Cskeg+r ++k++        +
                    7*****************************************9999554444431 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.2E-9476533IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.79770.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342877.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-155VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM5WU250.0M5WU25_PRUPE; Uncharacterized protein
STRINGVIT_12s0028g02670.t011e-170(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-149vascular plant one zinc finger protein